HKR1 polyclonal antibody
  • HKR1 polyclonal antibody

HKR1 polyclonal antibody

Ref: AB-PAB22950
HKR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HKR1.
Información adicional
Size 100 uL
Gene Name HKR1
Gene Alias -
Gene Description GLI-Kruppel family member HKR1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YPEDQKQQQDPFCFSGKAEWIQEGEDSRLLFGRVSKNGTSKALSSPPEEQQPAQSKEDNTVVDIGSSPER
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HKR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284459
Iso type IgG

Enviar uma mensagem


HKR1 polyclonal antibody

HKR1 polyclonal antibody