ZC3H6 polyclonal antibody
  • ZC3H6 polyclonal antibody

ZC3H6 polyclonal antibody

Ref: AB-PAB22938
ZC3H6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZC3H6.
Información adicional
Size 100 uL
Gene Name ZC3H6
Gene Alias FLJ16526|FLJ41410|FLJ45877|KIAA2035|ZC3HDC6
Gene Description zinc finger CCCH-type containing 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YHSPGFPGHVMKVPRENHCSPGSSYQQSPGEMQLNTNYESLQNPAEFYDNYYAQHSIHNFQPPNNSGDGMWHGEFAQQQPPVVQDSPNHGSGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZC3H6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 376940
Iso type IgG

Enviar uma mensagem


ZC3H6 polyclonal antibody

ZC3H6 polyclonal antibody