DNAJB14 polyclonal antibody
  • DNAJB14 polyclonal antibody

DNAJB14 polyclonal antibody

Ref: AB-PAB22937
DNAJB14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAJB14.
Información adicional
Size 100 uL
Gene Name DNAJB14
Gene Alias EGNR9427|FLJ14281|MGC22187|PRO34683
Gene Description DnaJ (Hsp40) homolog, subfamily B, member 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RKPSGSGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKDAGDED
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAJB14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79982
Iso type IgG

Enviar uma mensagem


DNAJB14 polyclonal antibody

DNAJB14 polyclonal antibody