ZSCAN23 polyclonal antibody
  • ZSCAN23 polyclonal antibody

ZSCAN23 polyclonal antibody

Ref: AB-PAB22934
ZSCAN23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZSCAN23.
Información adicional
Size 100 uL
Gene Name ZSCAN23
Gene Alias FLJ99276|MGC126606|MGC126608|ZNF390|ZNF453|dJ29K1.3|dJ29K1.3.1
Gene Description zinc finger and SCAN domain containing 23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HRPVSGEEAVTVLEDLERELDDPGEQVLSHAHEQEEFVKEKATPGAAQESSNDQFQTLEEQLGYNLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZSCAN23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222696
Iso type IgG

Enviar uma mensagem


ZSCAN23 polyclonal antibody

ZSCAN23 polyclonal antibody