ZNF488 polyclonal antibody
  • ZNF488 polyclonal antibody

ZNF488 polyclonal antibody

Ref: AB-PAB22933
ZNF488 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF488.
Información adicional
Size 100 uL
Gene Name ZNF488
Gene Alias FLJ32104
Gene Description zinc finger protein 488
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq WRLSEPELGRGCKPVLLEKTNRLGPEAAVGRAGRDVGSAELALLVAPGKPRPGKPLPPKTRGEQRQSAFTELPRMKDRQVD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF488.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 118738
Iso type IgG

Enviar uma mensagem


ZNF488 polyclonal antibody

ZNF488 polyclonal antibody