PAIP2 polyclonal antibody
  • PAIP2 polyclonal antibody

PAIP2 polyclonal antibody

Ref: AB-PAB22931
PAIP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PAIP2.
Información adicional
Size 100 uL
Gene Name PAIP2
Gene Alias MGC72018|PAIP2A
Gene Description poly(A) binding protein interacting protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PAIP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51247
Iso type IgG

Enviar uma mensagem


PAIP2 polyclonal antibody

PAIP2 polyclonal antibody