RBM27 polyclonal antibody
  • RBM27 polyclonal antibody

RBM27 polyclonal antibody

Ref: AB-PAB22930
RBM27 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM27.
Información adicional
Size 100 uL
Gene Name RBM27
Gene Alias ARRS1|KIAA1311|Psc1
Gene Description RNA binding motif protein 27
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LLLQQQQTLSHLSQQHHHLPQHLHQQQVLVAQSAPSTVHGGIQKMMSKPQTSGAYVLNKVPVKHRLGHAGGNQSDASHLLNQSGGAGEDCQIFS
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM27.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54439
Iso type IgG

Enviar uma mensagem


RBM27 polyclonal antibody

RBM27 polyclonal antibody