ARAP2 polyclonal antibody
  • ARAP2 polyclonal antibody

ARAP2 polyclonal antibody

Ref: AB-PAB22927
ARAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARAP2.
Información adicional
Size 100 uL
Gene Name ARAP2
Gene Alias CENTD1|FLJ13675|FLJ44916|KIAA0580|PARX
Gene Description ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq HCLEHKDDKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPKELQDEQI
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116984
Iso type IgG

Enviar uma mensagem


ARAP2 polyclonal antibody

ARAP2 polyclonal antibody