PLEKHA5 polyclonal antibody
  • PLEKHA5 polyclonal antibody

PLEKHA5 polyclonal antibody

Ref: AB-PAB22926
PLEKHA5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLEKHA5.
Información adicional
Size 100 uL
Gene Name PLEKHA5
Gene Alias FLJ10667|FLJ31492|KIAA1686|PEPP2
Gene Description pleckstrin homology domain containing, family A member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PRHSTLSSPKTMVNISDQTMHSIPTSPSHGSIAAYQGYSPQRTYRSEVSSPIQRGDVTIDRRHRAHHPKHVYVPDRRSVPAGLTLQSVSPQSLQGKTLSQD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLEKHA5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54477
Iso type IgG

Enviar uma mensagem


PLEKHA5 polyclonal antibody

PLEKHA5 polyclonal antibody