ARD1B polyclonal antibody
  • ARD1B polyclonal antibody

ARD1B polyclonal antibody

Ref: AB-PAB22924
ARD1B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARD1B.
Información adicional
Size 100 uL
Gene Name ARD1B
Gene Alias ARD2|MGC10646|hARD2
Gene Description ARD1 homolog B (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DELRRQMDLKKGGYVVLGSRENQETQGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARD1B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84779
Iso type IgG

Enviar uma mensagem


ARD1B polyclonal antibody

ARD1B polyclonal antibody