C4orf16 polyclonal antibody
  • C4orf16 polyclonal antibody

C4orf16 polyclonal antibody

Ref: AB-PAB22919
C4orf16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C4orf16.
Información adicional
Size 100 uL
Gene Name C4orf16
Gene Alias 2C18|GBAR|PRO0971
Gene Description chromosome 4 open reading frame 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVDLRERHYDSIAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C4orf16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55435
Iso type IgG

Enviar uma mensagem


C4orf16 polyclonal antibody

C4orf16 polyclonal antibody