THAP6 polyclonal antibody
  • THAP6 polyclonal antibody

THAP6 polyclonal antibody

Ref: AB-PAB22907
THAP6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant THAP6.
Información adicional
Size 100 uL
Gene Name THAP6
Gene Alias MGC30052
Gene Description THAP domain containing 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDTFCWDCCQESIEQDYIS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human THAP6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 152815
Iso type IgG

Enviar uma mensagem


THAP6 polyclonal antibody

THAP6 polyclonal antibody