UNC93A polyclonal antibody
  • UNC93A polyclonal antibody

UNC93A polyclonal antibody

Ref: AB-PAB22900
UNC93A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UNC93A.
Información adicional
Size 100 uL
Gene Name UNC93A
Gene Alias MGC119395|MGC119397|dJ366N23.1|dJ366N23.2
Gene Description unc-93 homolog A (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QPIRDVQRESEGEKKSVPFWSTLLSTFKLYRDKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UNC93A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54346
Iso type IgG

Enviar uma mensagem


UNC93A polyclonal antibody

UNC93A polyclonal antibody