CES4A polyclonal antibody
  • CES4A polyclonal antibody

CES4A polyclonal antibody

Ref: AB-PAB22896
CES4A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CES4A.
Información adicional
Size 100 uL
Gene Name CES4A
Gene Alias -
Gene Description hypothetical protein FLJ37464
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GDPGNVTLFGQSAGAMSISGLMMSPLASGLFHRAISQSGTALFRLFITSNPLKVAKKVAHLAGCNHNSTQILVNCLRALSGTKVMRVSNKMRFLQLNFQRDPEEIIWSMSPVVDGVVIPDDPLVLLTQGKVSSVPYL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CES4A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283848
Iso type IgG

Enviar uma mensagem


CES4A polyclonal antibody

CES4A polyclonal antibody