ZNF740 polyclonal antibody
  • ZNF740 polyclonal antibody

ZNF740 polyclonal antibody

Ref: AB-PAB22895
ZNF740 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF740.
Información adicional
Size 100 uL
Gene Name ZNF740
Gene Alias MGC61706|Zfp740
Gene Description zinc finger protein 740
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq AQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSDKSRSRKDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF740.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283337
Iso type IgG

Enviar uma mensagem


ZNF740 polyclonal antibody

ZNF740 polyclonal antibody