VILL polyclonal antibody
  • VILL polyclonal antibody

VILL polyclonal antibody

Ref: AB-PAB22894
VILL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant VILL.
Información adicional
Size 100 uL
Gene Name VILL
Gene Alias -
Gene Description villin-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IGWFFTWDPYKWTSHPSHKEVVDGSPAAASTISEITAEVNNLRLSRWPGNGRAGAVALQALKGSQDSSENDLVRSPKSAGSRTSSSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VILL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 50853
Iso type IgG

Enviar uma mensagem


VILL polyclonal antibody

VILL polyclonal antibody