RBM16 polyclonal antibody
  • RBM16 polyclonal antibody

RBM16 polyclonal antibody

Ref: AB-PAB22889
RBM16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM16.
Información adicional
Size 100 uL
Gene Name RBM16
Gene Alias KIAA1116|SCAF8
Gene Description RNA binding motif protein 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PRGPFPPGDIFSQPERPFLAPGRQSVDNVTNPEKRIPLGNDNIQQEGDRDYRFPPIETRESISRPPPVDVRDVVGRPIDPREGPGRPPLDGRDHFGRPPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22828
Iso type IgG

Enviar uma mensagem


RBM16 polyclonal antibody

RBM16 polyclonal antibody