TTC21B polyclonal antibody
  • TTC21B polyclonal antibody

TTC21B polyclonal antibody

Ref: AB-PAB22881
TTC21B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTC21B.
Información adicional
Size 100 uL
Gene Name TTC21B
Gene Alias FLJ11457|Nbla10696|THM1
Gene Description tetratricopeptide repeat domain 21B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ALAHEPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTC21B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79809
Iso type IgG

Enviar uma mensagem


TTC21B polyclonal antibody

TTC21B polyclonal antibody