EHBP1 polyclonal antibody
  • EHBP1 polyclonal antibody

EHBP1 polyclonal antibody

Ref: AB-PAB22878
EHBP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EHBP1.
Información adicional
Size 100 uL
Gene Name EHBP1
Gene Alias HPC12|KIAA0903|NACSIN
Gene Description EH domain binding protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LSPTSKLGYSYSRDLDLAKKKHASLRQTESDPDADRTTLNHADHSSKIVQHRLLSRQEELKERARVLLEQARRDAALKAGNKHNTNTATPF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EHBP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23301
Iso type IgG

Enviar uma mensagem


EHBP1 polyclonal antibody

EHBP1 polyclonal antibody