FAM217A polyclonal antibody
  • FAM217A polyclonal antibody

FAM217A polyclonal antibody

Ref: AB-PAB22877
FAM217A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM217A.
Información adicional
Size 100 uL
Gene Name FAM217A
Gene Alias RP5-1013A10.4|C6orf146
Gene Description family with sequence similarity 217, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SVDKQVGPYPGLPMPLGLCWPYADGDFFKNRNEIHVSSCSTIENNDGETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKPETIK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM217A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222826
Iso type IgG

Enviar uma mensagem


FAM217A polyclonal antibody

FAM217A polyclonal antibody