SFMBT2 polyclonal antibody
  • SFMBT2 polyclonal antibody

SFMBT2 polyclonal antibody

Ref: AB-PAB22875
SFMBT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SFMBT2.
Información adicional
Size 100 uL
Gene Name SFMBT2
Gene Alias -
Gene Description Scm-like with four mbt domains 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DFWCDVVIADLHPVGWCTQNNKVLMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGKGPIDLITVGSLIELQDSQN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SFMBT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57713
Iso type IgG

Enviar uma mensagem


SFMBT2 polyclonal antibody

SFMBT2 polyclonal antibody