CERKL polyclonal antibody
  • CERKL polyclonal antibody

CERKL polyclonal antibody

Ref: AB-PAB22874
CERKL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CERKL.
Información adicional
Size 100 uL
Gene Name CERKL
Gene Alias RP26
Gene Description ceramide kinase-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSMEEMI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CERKL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375298
Iso type IgG

Enviar uma mensagem


CERKL polyclonal antibody

CERKL polyclonal antibody