DHX36 polyclonal antibody
  • DHX36 polyclonal antibody

DHX36 polyclonal antibody

Ref: AB-PAB22871
DHX36 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DHX36.
Información adicional
Size 100 uL
Gene Name DHX36
Gene Alias DDX36|G4R1|KIAA1488|MLEL1|RHAU
Gene Description DEAH (Asp-Glu-Ala-His) box polypeptide 36
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DHX36.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 170506
Iso type IgG

Enviar uma mensagem


DHX36 polyclonal antibody

DHX36 polyclonal antibody