NDUFAF3 polyclonal antibody
  • NDUFAF3 polyclonal antibody

NDUFAF3 polyclonal antibody

Ref: AB-PAB22870
NDUFAF3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NDUFAF3.
Información adicional
Size 100 uL
Gene Name NDUFAF3
Gene Alias 2P1|DKFZp564J0123|E3-3|MGC10527
Gene Description chromosome 3 open reading frame 60
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NDUFAF3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25915
Iso type IgG

Enviar uma mensagem


NDUFAF3 polyclonal antibody

NDUFAF3 polyclonal antibody