GPR112 polyclonal antibody
  • GPR112 polyclonal antibody

GPR112 polyclonal antibody

Ref: AB-PAB22866
GPR112 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPR112.
Información adicional
Size 100 uL
Gene Name GPR112
Gene Alias DKFZp781E1948|PGR17|RP1-299I16
Gene Description G protein-coupled receptor 112
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq INTGKSQWEKPKFKQCKLLQELPDKIVDLANITISDENAEDVAEHILNLINESPALGKEETKIIVSKISDISQCDEISMNLTHVMLQIINVVLEKQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPR112.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 139378
Iso type IgG

Enviar uma mensagem


GPR112 polyclonal antibody

GPR112 polyclonal antibody