STX10 polyclonal antibody
  • STX10 polyclonal antibody

STX10 polyclonal antibody

Ref: AB-PAB22865
STX10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STX10.
Información adicional
Size 100 uL
Gene Name STX10
Gene Alias SYN10|hsyn10
Gene Description syntaxin 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIEEQQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STX10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8677
Iso type IgG

Enviar uma mensagem


STX10 polyclonal antibody

STX10 polyclonal antibody