PEAR1 polyclonal antibody
  • PEAR1 polyclonal antibody

PEAR1 polyclonal antibody

Ref: AB-PAB22861
PEAR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PEAR1.
Información adicional
Size 100 uL
Gene Name PEAR1
Gene Alias FLJ00193|JEDI|MEGF12
Gene Description platelet endothelial aggregation receptor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PSDPNTCSFWESFTTTTKESHSRPFSLLPSEPCERPWEGPHTCPQPTVVYRTVYRQVVKTDHRQRLQCCHGFYES
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PEAR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375033
Iso type IgG

Enviar uma mensagem


PEAR1 polyclonal antibody

PEAR1 polyclonal antibody