ZFAND2B polyclonal antibody
  • ZFAND2B polyclonal antibody

ZFAND2B polyclonal antibody

Ref: AB-PAB22857
ZFAND2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZFAND2B.
Información adicional
Size 100 uL
Gene Name ZFAND2B
Gene Alias -
Gene Description zinc finger, AN1-type domain 2B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq CPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKH
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZFAND2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 130617
Iso type IgG

Enviar uma mensagem


ZFAND2B polyclonal antibody

ZFAND2B polyclonal antibody