TBC1D5 polyclonal antibody
  • TBC1D5 polyclonal antibody

TBC1D5 polyclonal antibody

Ref: AB-PAB22854
TBC1D5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TBC1D5.
Información adicional
Size 100 uL
Gene Name TBC1D5
Gene Alias KIAA0210
Gene Description TBC1 domain family, member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DVKRTFPEMQFFQQENVRKILTDVLFCYARENEQLLYKQGMHELLAPIVFVLHCDHQAFLHASESAQPSEEMKTVLNPEYLEHDAYAVFSQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TBC1D5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9779
Iso type IgG

Enviar uma mensagem


TBC1D5 polyclonal antibody

TBC1D5 polyclonal antibody