UBAP2L polyclonal antibody
  • UBAP2L polyclonal antibody

UBAP2L polyclonal antibody

Ref: AB-PAB22848
UBAP2L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UBAP2L.
Información adicional
Size 100 uL
Gene Name UBAP2L
Gene Alias FLJ42300|KIAA0144|NICE-4
Gene Description ubiquitin associated protein 2-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UBAP2L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9898
Iso type IgG

Enviar uma mensagem


UBAP2L polyclonal antibody

UBAP2L polyclonal antibody