ETAA1 polyclonal antibody
  • ETAA1 polyclonal antibody

ETAA1 polyclonal antibody

Ref: AB-PAB22845
ETAA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ETAA1.
Información adicional
Size 100 uL
Gene Name ETAA1
Gene Alias ETAA16|FLJ22647
Gene Description Ewing tumor-associated antigen 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DMPELFPSKTAHVTDQKEICTFNSKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ETAA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54465
Iso type IgG

Enviar uma mensagem


ETAA1 polyclonal antibody

ETAA1 polyclonal antibody