FAM26E polyclonal antibody
  • FAM26E polyclonal antibody

FAM26E polyclonal antibody

Ref: AB-PAB22841
FAM26E polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM26E.
Información adicional
Size 100 uL
Gene Name FAM26E
Gene Alias C6orf188|MGC45451|dJ493F7.3
Gene Description family with sequence similarity 26, member E
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YECAMSGTRSSGLLELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM26E.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 254228
Iso type IgG

Enviar uma mensagem


FAM26E polyclonal antibody

FAM26E polyclonal antibody