POL3S polyclonal antibody
  • POL3S polyclonal antibody

POL3S polyclonal antibody

Ref: AB-PAB22839
POL3S polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant POL3S.
Información adicional
Size 100 uL
Gene Name POL3S
Gene Alias FLJ00289|UNQ308
Gene Description polyserase 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ELPSCEGLSGAPLVHEVRGTWFLAGLHSFGDACQGPARPAVFTALPAYEDWVSSLDWQVYFAEEPEPEAEPGSCLANISQPTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human POL3S.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339105
Iso type IgG

Enviar uma mensagem


POL3S polyclonal antibody

POL3S polyclonal antibody