MYH15 polyclonal antibody
  • MYH15 polyclonal antibody

MYH15 polyclonal antibody

Ref: AB-PAB22837
MYH15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYH15.
Información adicional
Size 100 uL
Gene Name MYH15
Gene Alias -
Gene Description myosin, heavy chain 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KMERERADLTQDLADLNERLEEVGGSSLAQLEITKKQETKFQKLHRDMEEATLHFETTSASLKKRH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYH15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22989
Iso type IgG

Enviar uma mensagem


MYH15 polyclonal antibody

MYH15 polyclonal antibody