SF3B14 polyclonal antibody
  • SF3B14 polyclonal antibody

SF3B14 polyclonal antibody

Ref: AB-PAB22832
SF3B14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SF3B14.
Información adicional
Size 100 uL
Gene Name SF3B14
Gene Alias CGI-110|HSPC175|Ht006|P14|SAP14|SF3B14a
Gene Description splicing factor 3B, 14 kDa subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SF3B14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51639
Iso type IgG

Enviar uma mensagem


SF3B14 polyclonal antibody

SF3B14 polyclonal antibody