GFM1 polyclonal antibody
  • GFM1 polyclonal antibody

GFM1 polyclonal antibody

Ref: AB-PAB22827
GFM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GFM1.
Información adicional
Size 100 uL
Gene Name GFM1
Gene Alias COXPD1|EFG|EFG1|EFGM|EGF1|FLJ12662|FLJ13632|FLJ20773|GFM|hEFG1
Gene Description G elongation factor, mitochondrial 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GFM1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85476
Iso type IgG

Enviar uma mensagem


GFM1 polyclonal antibody

GFM1 polyclonal antibody