PSD4 polyclonal antibody
  • PSD4 polyclonal antibody

PSD4 polyclonal antibody

Ref: AB-PAB22819
PSD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSD4.
Información adicional
Size 100 uL
Gene Name PSD4
Gene Alias EFA6B|FLJ36237|FLJ37279|TIC
Gene Description pleckstrin and Sec7 domain containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EESMFFSNPLFLASPCSENSASGECFSWGASDSHAGVRTGPESPATLEPPLPEDTVLWELESEPDLGDGAAISGHCTPPFPVPIYKPHSI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSD4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23550
Iso type IgG

Enviar uma mensagem


PSD4 polyclonal antibody

PSD4 polyclonal antibody