METTL21A polyclonal antibody
  • METTL21A polyclonal antibody

METTL21A polyclonal antibody

Ref: AB-PAB22818
METTL21A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant METTL21A.
Información adicional
Size 100 uL
Gene Name METTL21A
Gene Alias FAM119A|HCA557b
Gene Description methyltransferase like 21A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQKRNQKEDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human METTL21A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 151194
Iso type IgG

Enviar uma mensagem


METTL21A polyclonal antibody

METTL21A polyclonal antibody