PPP4R2 polyclonal antibody
  • PPP4R2 polyclonal antibody

PPP4R2 polyclonal antibody

Ref: AB-PAB22816
PPP4R2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPP4R2.
Información adicional
Size 100 uL
Gene Name PPP4R2
Gene Alias MGC131930
Gene Description protein phosphatase 4, regulatory subunit 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq NHSDSSTSESEVSSVSPLKNKHPDEDAVEAEGHEVKRLRFDKEGEVRETASQTTSSEISSVMVGETEASSSSQDKDKDSRCTRQH
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPP4R2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 151987
Iso type IgG

Enviar uma mensagem


PPP4R2 polyclonal antibody

PPP4R2 polyclonal antibody