SCRN3 polyclonal antibody
  • SCRN3 polyclonal antibody

SCRN3 polyclonal antibody

Ref: AB-PAB22815
SCRN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCRN3.
Información adicional
Size 100 uL
Gene Name SCRN3
Gene Alias FLJ23142|MGC149597|SES3
Gene Description secernin 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DMRNYAKRKGWWDGKKEFDFAAAYSYLDTAKMMTSSGRYCEGYKLLNKHKGNITFETMMEILRDKPSGINMEGEFLTTA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCRN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79634
Iso type IgG

Enviar uma mensagem


SCRN3 polyclonal antibody

SCRN3 polyclonal antibody