SPOPL polyclonal antibody
  • SPOPL polyclonal antibody

SPOPL polyclonal antibody

Ref: AB-PAB22813
SPOPL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPOPL.
Información adicional
Size 100 uL
Gene Name SPOPL
Gene Alias FLJ53775
Gene Description speckle-type POZ protein-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMIQSHPHLVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPOPL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339745
Iso type IgG

Enviar uma mensagem


SPOPL polyclonal antibody

SPOPL polyclonal antibody