SYCP2L polyclonal antibody
  • SYCP2L polyclonal antibody

SYCP2L polyclonal antibody

Ref: AB-PAB22811
SYCP2L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SYCP2L.
Información adicional
Size 100 uL
Gene Name SYCP2L
Gene Alias C6orf177|NO145|dJ62D2.1
Gene Description synaptonemal complex protein 2-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TSMICVIEDFFDTALIISRSSSEGKIQMLDSFLLSLGFLVTEKTVNHLLQQEGLKTFNCILHAVPREERKKFPLSEGMCHLMKDLARTLLTVGDYDQQV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYCP2L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221711
Iso type IgG

Enviar uma mensagem


SYCP2L polyclonal antibody

SYCP2L polyclonal antibody