C10orf35 polyclonal antibody
  • C10orf35 polyclonal antibody

C10orf35 polyclonal antibody

Ref: AB-PAB22808
C10orf35 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C10orf35.
Información adicional
Size 100 uL
Gene Name C10orf35
Gene Alias -
Gene Description chromosome 10 open reading frame 35
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MSPVLSGIHSIYSAWVTSVNITDCKPPSISGAAHQGPTAPGRMVRILANGEIVQDDDPRVRTTTQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C10orf35.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219738
Iso type IgG

Enviar uma mensagem


C10orf35 polyclonal antibody

C10orf35 polyclonal antibody