TMLHE polyclonal antibody
  • TMLHE polyclonal antibody

TMLHE polyclonal antibody

Ref: AB-PAB22807
TMLHE polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMLHE.
Información adicional
Size 100 uL
Gene Name TMLHE
Gene Alias BBOX2|FLJ10727|TMLH|XAP130
Gene Description trimethyllysine hydroxylase, epsilon
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMLHE.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55217
Iso type IgG

Enviar uma mensagem


TMLHE polyclonal antibody

TMLHE polyclonal antibody