PEX13 polyclonal antibody
  • PEX13 polyclonal antibody

PEX13 polyclonal antibody

Ref: AB-PAB22801
PEX13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PEX13.
Información adicional
Size 100 uL
Gene Name PEX13
Gene Alias NALD|ZWS
Gene Description peroxisomal biogenesis factor 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SADLGPTLMTRPGQPALTRVPPPILPRPSQQTGSSSVNTFRPAYSSFSSGYGAYGNSFYGGYSPYSYGYNGLGYNRLRVDDLPPSRFVQQAEESSRGA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PEX13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5194
Iso type IgG

Enviar uma mensagem


PEX13 polyclonal antibody

PEX13 polyclonal antibody