UHRF1BP1 polyclonal antibody
  • UHRF1BP1 polyclonal antibody

UHRF1BP1 polyclonal antibody

Ref: AB-PAB22797
UHRF1BP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UHRF1BP1.
Información adicional
Size 100 uL
Gene Name UHRF1BP1
Gene Alias C6orf107|FLJ20302|ICBP90|dJ349A12.1
Gene Description UHRF1 binding protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VQSEALAPDSMSHPRSKTEHDLKSLSGLTEVMEILKEGSSGMDNKGPLTELEDVADVHMLVHSPAHVRVRLDHYQYLALLRLKEVLQRLQEQLTKDTESMTGSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UHRF1BP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54887
Iso type IgG

Enviar uma mensagem


UHRF1BP1 polyclonal antibody

UHRF1BP1 polyclonal antibody