TATDN3 polyclonal antibody
  • TATDN3 polyclonal antibody

TATDN3 polyclonal antibody

Ref: AB-PAB22794
TATDN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TATDN3.
Información adicional
Size 100 uL
Gene Name TATDN3
Gene Alias MGC142198
Gene Description TatD DNase domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TATDN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 128387
Iso type IgG

Enviar uma mensagem


TATDN3 polyclonal antibody

TATDN3 polyclonal antibody