PLEKHN1 polyclonal antibody
  • PLEKHN1 polyclonal antibody

PLEKHN1 polyclonal antibody

Ref: AB-PAB22785
PLEKHN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLEKHN1.
Información adicional
Size 100 uL
Gene Name PLEKHN1
Gene Alias DKFZp434H2010|MGC120613|MGC120616|RP11-54O7.7
Gene Description pleckstrin homology domain containing, family N member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IFSEELDGLCFKGELPLRAVHINLEEKEKQIRSFLIEGPLINTIRVVCASYEDYGHWLLCLRAVTHREGAPPLPGAESFPGSQV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLEKHN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84069
Iso type IgG

Enviar uma mensagem


PLEKHN1 polyclonal antibody

PLEKHN1 polyclonal antibody