BCKDHB polyclonal antibody
  • BCKDHB polyclonal antibody

BCKDHB polyclonal antibody

Ref: AB-PAB22782
BCKDHB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BCKDHB.
Información adicional
Size 100 uL
Gene Name BCKDHB
Gene Alias E1B|FLJ17880|dJ279A18.1
Gene Description branched chain keto acid dehydrogenase E1, beta polypeptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BCKDHB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 594
Iso type IgG

Enviar uma mensagem


BCKDHB polyclonal antibody

BCKDHB polyclonal antibody