C6orf190 polyclonal antibody
  • C6orf190 polyclonal antibody

C6orf190 polyclonal antibody

Ref: AB-PAB22780
C6orf190 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf190.
Información adicional
Size 100 uL
Gene Name THEMIS
Gene Alias C6orf207|FLJ40584|MGC163388|bA325O24.3|bA325O24.4
Gene Description chromosome 6 open reading frame 190
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EGCESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNSVEEIDGEIMVSCAVARNHQTHSF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C6orf190.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 387357
Iso type IgG

Enviar uma mensagem


C6orf190 polyclonal antibody

C6orf190 polyclonal antibody